Shopping Cart
- Remove All
Your shopping cart is currently empty
SDF-1α (human) serves as a chemotactic agent for mononuclear cells through its interaction with the CXCR4 receptor, facilitating critical biological processes such as stem cell homing, retention, survival, and proliferation, in addition to cardiomyocyte repair, angiogenesis, and ventricular remodeling post-myocardial infarction. It holds significant utility in cardiovascular disease research [1] [2].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | SDF-1α (human) serves as a chemotactic agent for mononuclear cells through its interaction with the CXCR4 receptor, facilitating critical biological processes such as stem cell homing, retention, survival, and proliferation, in addition to cardiomyocyte repair, angiogenesis, and ventricular remodeling post-myocardial infarction. It holds significant utility in cardiovascular disease research [1] [2]. |
| Molecular Weight | 7959.34 |
| Formula | C356H578N106O93S4 |
| Cas No. | 1268129-65-2 |
| Sequence | Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys |
| Sequence Short | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK (Disulfide bridge:Cys9-Cys34;Cys11-Cys50) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.