Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

retro-inverso TAT-Beclin 1 (D-amino acid)

😃Good
Catalog No. TP3320

The compound retro-inverso TAT-Beclin 1 D-amino acid demonstrates superior activity and resistance to proteolytic degradation compared to the L-amino acid peptide when used in vivo. TAT-Beclin 1 is capable of inducing autophagy in peripheral tissues of adult mice and in the central nervous system of newborn mice.

retro-inverso TAT-Beclin 1 (D-amino acid)

retro-inverso TAT-Beclin 1 (D-amino acid)

😃Good
Catalog No. TP3320
The compound retro-inverso TAT-Beclin 1 D-amino acid demonstrates superior activity and resistance to proteolytic degradation compared to the L-amino acid peptide when used in vivo. TAT-Beclin 1 is capable of inducing autophagy in peripheral tissues of adult mice and in the central nervous system of newborn mice.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
10 mgInquiryInquiryInquiry
50 mgInquiryInquiryInquiry
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
TargetMol
View More

Resource Download

Product Introduction

Bioactivity
Description
The compound retro-inverso TAT-Beclin 1 D-amino acid demonstrates superior activity and resistance to proteolytic degradation compared to the L-amino acid peptide when used in vivo. TAT-Beclin 1 is capable of inducing autophagy in peripheral tissues of adult mice and in the central nervous system of newborn mice.
Chemical Properties
FormulaC164H251N57O45
Sequenced-(Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Tyr-Gly-Gly-Thr-Gly-Phe-Glu-Gly-Asp-His-Trp-Ile-Glu-Phe-Thr-Ala-Asn-Phe-Val-Asn-Thr)
Sequence Shortd-(RRRQRRKKRGYGGTGFEGDHWIEFTANFVNT)
Storage & Solubility Information
Storagekeep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
TargetMol | Animal experiments For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent 10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.
Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSOTargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSOTargetMol | reagent stock solution to 400 μL PEG300TargetMol | reagent and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH2OTargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Related Tags: buy retro-inverso TAT-Beclin 1 (D-amino acid) | purchase retro-inverso TAT-Beclin 1 (D-amino acid) | retro-inverso TAT-Beclin 1 (D-amino acid) cost | order retro-inverso TAT-Beclin 1 (D-amino acid) | retro-inverso TAT-Beclin 1 (D-amino acid) formula