Shopping Cart
Remove All
Your shopping cart is currently empty
Preptin, an osteogenic peptide derived from pancreatic beta-cells, spans amino acids Asp 69 to Leu 102 within pro-IGF-II [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Preptin, an osteogenic peptide derived from pancreatic beta-cells, spans amino acids Asp 69 to Leu 102 within pro-IGF-II [1]. |
| In vitro | 'Preptin enhances the proliferation of primary fetal rat osteoblasts and osteoblast-like cell lines in a dose-dependent manner at periphysiological concentrations (10^-11 M), as evidenced by increased cell number and DNA synthesis [1].' |
| Cas No. | 315197-73-0 |
| Sequence | Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu |
| Sequence Short | DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.