Your shopping cart is currently empty

Preptin, an osteogenic peptide derived from pancreatic beta-cells, spans amino acids Asp 69 to Leu 102 within pro-IGF-II [1].

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Preptin, an osteogenic peptide derived from pancreatic beta-cells, spans amino acids Asp 69 to Leu 102 within pro-IGF-II [1]. |
| In vitro | 'Preptin enhances the proliferation of primary fetal rat osteoblasts and osteoblast-like cell lines in a dose-dependent manner at periphysiological concentrations (10^-11 M), as evidenced by increased cell number and DNA synthesis [1].' |
| Cas No. | 315197-73-0 |
| Sequence | Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu |
| Sequence Short | DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.