Shopping Cart
- Remove All
- Your shopping cart is currently empty
Preptin, an osteogenic peptide derived from pancreatic beta-cells, spans amino acids Asp 69 to Leu 102 within pro-IGF-II [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Preptin, an osteogenic peptide derived from pancreatic beta-cells, spans amino acids Asp 69 to Leu 102 within pro-IGF-II [1]. |
In vitro | 'Preptin enhances the proliferation of primary fetal rat osteoblasts and osteoblast-like cell lines in a dose-dependent manner at periphysiological concentrations (10^-11 M), as evidenced by increased cell number and DNA synthesis [1].' |
Cas No. | 315197-73-0 |
Sequence | Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu |
Sequence Short | DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.