Shopping Cart
- Remove All
- Your shopping cart is currently empty
Peptide YY (pig), a 36-amino acid gastrointestinal peptide isolated from porcine duodenum, suppresses appetite and reduces food intake through activation of the Y2 receptor. Predominantly located in pancreatic endocrine cells, it influences intestinal motility and impacts the cardiovascular system [1] [2] [3].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Peptide YY (pig), a 36-amino acid gastrointestinal peptide isolated from porcine duodenum, suppresses appetite and reduces food intake through activation of the Y2 receptor. Predominantly located in pancreatic endocrine cells, it influences intestinal motility and impacts the cardiovascular system [1] [2] [3]. |
Molecular Weight | 4240.72 |
Formula | C190H288N54O57 |
Cas No. | 81858-94-8 |
Sequence Short | YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.