Shopping Cart
Remove All
Your shopping cart is currently empty
Pepinh-TRIF TFA is a 30 aa peptide associated with the immune system that blocks TRIF signaling by interfering with TLR-TRIF interaction (TLR-TRIF interaction ).

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $128 | In Stock | In Stock | |
| 5 mg | $293 | - | In Stock | |
| 10 mg | $488 | - | In Stock | |
| 25 mg | $783 | - | In Stock | |
| 50 mg | $1,060 | Inquiry | Inquiry |
| Description | Pepinh-TRIF TFA is a 30 aa peptide associated with the immune system that blocks TRIF signaling by interfering with TLR-TRIF interaction (TLR-TRIF interaction ). |
| In vitro | Pepinh-TRIF TFA (40 μM, 6 h) effectively blocked polyI: C or flagellin-stimulated IL-33 expression and production, and significantly inhibited stimulated IκB-α phosphorylation and its degradation in HCECs. [1] In addition, Pepinh-TRIF TFA blocked NF-κB activation by inhibiting the intranuclear translocation of p65 protein. [1] |
| Formula | C180H279F3N58O40S2 |
| Color | White |
| Appearance | Solid |
| Sequence | Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Phe-Cys-Glu-Glu-Phe-Gln-Val-Pro-Gly-Arg-Gly-Glu-Leu-His-Asn-His |
| Sequence Short | RQIKIWFQNRRMKWKKFCEEFQVPGRGELH-NH2 |
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 40.01 mg/mL, Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.