Your shopping cart is currently empty

Pepinh-TRIF TFA is a 30 aa peptide associated with the immune system that blocks TRIF signaling by interfering with TLR-TRIF interaction (TLR-TRIF interaction ).


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $128 | In Stock | In Stock | |
| 5 mg | $293 | - | In Stock | |
| 10 mg | $488 | - | In Stock | |
| 25 mg | $783 | Inquiry | Inquiry | |
| 50 mg | $1,060 | Inquiry | Inquiry |
| Description | Pepinh-TRIF TFA is a 30 aa peptide associated with the immune system that blocks TRIF signaling by interfering with TLR-TRIF interaction (TLR-TRIF interaction ). |
| In vitro | Pepinh-TRIF TFA (40 μM, 6 h) effectively blocked polyI: C or flagellin-stimulated IL-33 expression and production, and significantly inhibited stimulated IκB-α phosphorylation and its degradation in HCECs. [1] In addition, Pepinh-TRIF TFA blocked NF-κB activation by inhibiting the intranuclear translocation of p65 protein. [1] |
| Formula | C180H279F3N58O40S2 |
| Sequence | Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Phe-Cys-Glu-Glu-Phe-Gln-Val-Pro-Gly-Arg-Gly-Glu-Leu-His-Asn-His |
| Sequence Short | RQIKIWFQNRRMKWKKFCEEFQVPGRGELH |
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 40.01 mg/mL, Sonication is recommended. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.