Shopping Cart
- Remove All
- Your shopping cart is currently empty
Pepinh-TRIF TFA is a 30 aa peptide associated with the immune system that blocks TRIF signaling by interfering with TLR-TRIF interaction (TLR-TRIF interaction ).
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $128 | In Stock | |
5 mg | $293 | In Stock | |
10 mg | $488 | In Stock | |
25 mg | $783 | In Stock | |
50 mg | $1,060 | Backorder |
Description | Pepinh-TRIF TFA is a 30 aa peptide associated with the immune system that blocks TRIF signaling by interfering with TLR-TRIF interaction (TLR-TRIF interaction ). |
In vitro | Pepinh-TRIF TFA (40 μM, 6 h) effectively blocked polyI: C or flagellin-stimulated IL-33 expression and production, and significantly inhibited stimulated IκB-α phosphorylation and its degradation in HCECs. [1] In addition, Pepinh-TRIF TFA blocked NF-κB activation by inhibiting the intranuclear translocation of p65 protein. [1] |
Formula | C180H279F3N58O40S2 |
Sequence | Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Phe-Cys-Glu-Glu-Phe-Gln-Val-Pro-Gly-Arg-Gly-Glu-Leu-His-Asn-His |
Sequence Short | RQIKIWFQNRRMKWKKFCEEFQVPGRGELH-NH2 |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 40 mg/mL (9.96 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.