Shopping Cart
- Remove All
Your shopping cart is currently empty
Parstatin(human) TFA, a cell-penetrating PAR-1 thrombin receptor agonist peptide, effectively inhibits angiogenesis, as indicated by studies [1][2].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Parstatin(human) TFA, a cell-penetrating PAR-1 thrombin receptor agonist peptide, effectively inhibits angiogenesis, as indicated by studies [1][2]. |
| Molecular Weight | 4581.28 |
| Formula | C193H331F3N64O55S3 |
| Sequence Short | MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.