Shopping Cart
- Remove All
- Your shopping cart is currently empty
Pancreastatin (swine), a 49-residue peptide derived from porcine pancreas [1], significantly suppresses the release of insulin in response to glucose.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Pancreastatin (swine), a 49-residue peptide derived from porcine pancreas [1], significantly suppresses the release of insulin in response to glucose. |
Cas No. | 106477-83-2 |
Sequence Short | GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.