Your shopping cart is currently empty

palm-PrRP31 is a potent dual agonist for GPR10 (EC50=72 pM) and NPFF-R2. It activates downstream signaling pathways by binding to GPR10 and NPFF-R2 receptors, leading to reduced appetite and increased energy expenditure. palm-PrRP31 can be utilized to investigate its mechanism of action in the nervous system, thereby elucidating the complex biological processes involved in the regulation of appetite and energy expenditure.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | palm-PrRP31 is a potent dual agonist for GPR10 (EC50=72 pM) and NPFF-R2. It activates downstream signaling pathways by binding to GPR10 and NPFF-R2 receptors, leading to reduced appetite and increased energy expenditure. palm-PrRP31 can be utilized to investigate its mechanism of action in the nervous system, thereby elucidating the complex biological processes involved in the regulation of appetite and energy expenditure. |
| Formula | C176H282N56O43S |
| Sequence | {N-palm-Ser}-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 (palm=palmitoyl (C16)) |
| Sequence Short | {N-palm-Ser}-RTHRHSMEIRTPDINPAWYASRGIRPVGRF (palm=palmitoyl (C16)) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.