Shopping Cart
Remove All
Your shopping cart is currently empty
Nocistatin (human) TFA inhibits the allodynia and hyperalgesia induced by nociceptin and mitigates pain triggered by prostaglandin E2 [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Nocistatin (human) TFA inhibits the allodynia and hyperalgesia induced by nociceptin and mitigates pain triggered by prostaglandin E2 [1]. |
| In vitro | Nocistatin (5. |
| Sequence | Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln |
| Sequence Short | MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.