Shopping Cart
- Remove All
- Your shopping cart is currently empty
Blocker of nociceptin-induced allodynia and hyperalgesia
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $432 | Backorder |
Description | Blocker of nociceptin-induced allodynia and hyperalgesia |
Synonyms | Nocistatin (human) |
Molecular Weight | 3561.93 |
Formula | C149H238N42O53S3 |
Cas No. | 212609-11-5 |
Relative Density. | 1.54 g/cm3 (Predicted) |
Sequence | Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln |
Sequence Short | MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.