Shopping Cart
- Remove All
- Your shopping cart is currently empty
Mecasermin (Human IGF-I; FK 780), a recombinant form of human insulin-like growth factor I (IGF-I), is promising for investigating growth failure attributed to growth hormone (GH) insensitivity due to defects in GH receptors or the presence of GH-inhibiting antibodies [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Mecasermin (Human IGF-I; FK 780), a recombinant form of human insulin-like growth factor I (IGF-I), is promising for investigating growth failure attributed to growth hormone (GH) insensitivity due to defects in GH receptors or the presence of GH-inhibiting antibodies [1]. |
Molecular Weight | 7645.68 |
Formula | C331H512N94O101S7 |
Cas No. | 68562-41-4 |
Sequence | Gly-Pro-Glu-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu |
Sequence Short | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Disulfide bridge:Cys6-Cys48;Cys18-Cys61;Cys47-Cys52) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.