Shopping Cart
- Remove All
- Your shopping cart is currently empty
L-JNKI-1, a cell-permeable peptide inhibitor specific for JNK, has been shown to effectively inhibit JNK activity in in vivo studies.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $148 | Backorder | |
5 mg | $297 | Backorder | |
10 mg | $445 | Backorder | |
50 mg | $1,143 | Backorder |
Description | L-JNKI-1, a cell-permeable peptide inhibitor specific for JNK, has been shown to effectively inhibit JNK activity in in vivo studies. |
Molecular Weight | 3822.44 |
Formula | C164H286N66O40 |
Relative Density. | no data available |
Sequence | Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2 |
Sequence Short | DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
Solubility Information | H2O: 100 mg/mL (26.16 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.