Shopping Cart
- Remove All
- Your shopping cart is currently empty
Iberiotoxin (TFA) is a selective inhibitor of high conductance Ca2+-activated K+ channels, with a dissociation constant (Kd) of approximately 1 nM, and does not inhibit other types of voltage-dependent ion channels [1] [2] [3].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Iberiotoxin (TFA) is a selective inhibitor of high conductance Ca2+-activated K+ channels, with a dissociation constant (Kd) of approximately 1 nM, and does not inhibit other types of voltage-dependent ion channels [1] [2] [3]. |
Molecular Weight | 4230.85 (free base) |
Formula | C179H274N50O55S7.xC2HF3O2 |
Sequence | {Glp}-Phe-Thr-Asp-Val-Asp-Cys-Ser-Val-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Lys-Asp-Leu-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Arg-Cys-Tyr-Gln (Disulfide bridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35) |
Sequence Short | {Glp}-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Disulfide bridge:Cys7-Cys28,Cys13-Cys33,Cys17-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.