Shopping Cart
- Remove All
- Your shopping cart is currently empty
Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide, a biotin-labeled variant of glucagon-like peptide-1-(7-36), is a gastrointestinal peptide known for its antidiabetogenic properties, including enhancing insulin secretion [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide, a biotin-labeled variant of glucagon-like peptide-1-(7-36), is a gastrointestinal peptide known for its antidiabetogenic properties, including enhancing insulin secretion [1] [2]. |
Molecular Weight | 3652.1 |
Formula | C165H252N44O48S |
Sequence Short | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-{Biotin-Lys}-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.