Shopping Cart
- Remove All
- Your shopping cart is currently empty
Glucagon-like peptide 1 (1-37), human (TFA), is a highly potent agonist of the GLP-1 receptor and is a pancreatic hormone synthesized through post-translational processing of proglucagon.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $360 | Backorder |
Description | Glucagon-like peptide 1 (1-37), human (TFA), is a highly potent agonist of the GLP-1 receptor and is a pancreatic hormone synthesized through post-translational processing of proglucagon. |
Alias | HuGLP-1 TFA |
Molecular Weight | 4283.5 |
Formula | C188H276N51F3O61 |
Relative Density. | no data available |
Sequence | His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
Sequence Short | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.