Shopping Cart
- Remove All
- Your shopping cart is currently empty
GLP-2(rat) TFA, an intestinal growth factor, promotes cell proliferation and prevents apoptosis. Additionally, it increases mucosal mass and function in the residual small intestine following massive small bowel resection (MSBR), as documented in references [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | GLP-2(rat) TFA, an intestinal growth factor, promotes cell proliferation and prevents apoptosis. Additionally, it increases mucosal mass and function in the residual small intestine following massive small bowel resection (MSBR), as documented in references [1] [2]. |
Molecular Weight | 3910.16 |
Formula | C168H257F3N44O58S |
Sequence | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
Sequence Short | HADGSFSDEMNTILDNLATRDFINWLIQTKITD |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.