Shopping Cart
- Remove All
- Your shopping cart is currently empty
The GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide, a glucagon-like peptide 1 receptor (GLP-1) agonist.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $346 | Backorder | |
5 mg | $1,098 | Backorder |
Description | The GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide, a glucagon-like peptide 1 receptor (GLP-1) agonist. |
Molecular Weight | 3314.62 |
Formula | C149H221N37O49 |
Relative Density. | no data available |
Sequence Short | HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.