Shopping Cart
- Remove All
- Your shopping cart is currently empty
This GIP fragment has potent insulinotropic activity in the isolated, perfused rat pancreas but greatly reduced somatostatinotropic activity in the isolated perfused rat stomach. The site responsible for insulinotropic activity apparently lies between residues 19 and 30 of GIP.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $662 | Backorder |
Description | This GIP fragment has potent insulinotropic activity in the isolated, perfused rat pancreas but greatly reduced somatostatinotropic activity in the isolated perfused rat stomach. The site responsible for insulinotropic activity apparently lies between residues 19 and 30 of GIP. |
Molecular Weight | 3551.04 |
Formula | C162H245N41O47S |
Cas No. | 134846-93-8 |
Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 |
Sequence Short | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | DMSO: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.