Shopping Cart
- Remove All
- Your shopping cart is currently empty
Gastric Inhibitory Peptide (porcine), also known as a glucose-dependent insulinotropic polypeptide, is a 42-amino acid intestinal hormone that influences fat and glucose metabolism [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Gastric Inhibitory Peptide (porcine), also known as a glucose-dependent insulinotropic polypeptide, is a 42-amino acid intestinal hormone that influences fat and glucose metabolism [1]. |
Molecular Weight | 4975.55 |
Formula | C225H342N60O66S |
Cas No. | 11063-17-5 |
Sequence Short | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.