Shopping Cart
- Remove All
- Your shopping cart is currently empty
Galanin-Like Peptide (porcine) is a 60 amino acid neuropeptide originally isolated from the porcine hypothalamus, exhibiting high affinity for the GALR2 receptor with an IC50 of 0.24 nM, and comparatively lower affinity for the GALR1 receptor with an IC50 of 4.3 nM [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Galanin-Like Peptide (porcine) is a 60 amino acid neuropeptide originally isolated from the porcine hypothalamus, exhibiting high affinity for the GALR2 receptor with an IC50 of 0.24 nM, and comparatively lower affinity for the GALR1 receptor with an IC50 of 4.3 nM [1]. |
Molecular Weight | 6204.02 |
Formula | C281H443N81O78 |
Cas No. | 245114-96-9 |
Sequence | Ala-Pro-Val-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Pro-Pro-Ser-Arg-Ala-Glu-Gly-Gly-Gly-Lys-Gly-Lys-Thr-Ala-Leu-Gly-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Pro-Gln-Ser-Gln-Leu-Ala-Ser |
Sequence Short | APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.