Shopping Cart
- Remove All
Your shopping cart is currently empty
Galanin-Like Peptide (human) is a neuropeptide composed of 60 amino acids, crucial for regulating feeding, body weight, and energy metabolism [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Galanin-Like Peptide (human) is a neuropeptide composed of 60 amino acids, crucial for regulating feeding, body weight, and energy metabolism [1]. |
| Molecular Weight | 6500.28 |
| Formula | C292H451N83O84S |
| Cas No. | 245114-99-2 |
| Sequence | Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro-Pro-Gln-Pro-Ser |
| Sequence Short | APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.