Shopping Cart
- Remove All
- Your shopping cart is currently empty
Potent, high affinity apelin receptor agonist (IC50 = 0.27 nM; Kd = 0.51 nM). Exhibits no binding GPR15 and GPR25. Activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. Also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. Stimulates angiogenesis in HUVEC cells. Relaxes mouse aortic vessels. Functions as an anorexigenic hormone through activation of the AVP and CRH neurons in the PVN.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $544 | Backorder |
Description | Potent, high affinity apelin receptor agonist (IC50 = 0.27 nM; Kd = 0.51 nM). Exhibits no binding GPR15 and GPR25. Activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. Also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. Stimulates angiogenesis in HUVEC cells. Relaxes mouse aortic vessels. Functions as an anorexigenic hormone through activation of the AVP and CRH neurons in the PVN. |
Synonyms | ELA-32 (human) |
Molecular Weight | 3967.8 |
Formula | C170H289N63O39S4 |
Cas No. | 1680205-79-1 |
Relative Density. | no data available |
Sequence | Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Arg-Arg-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro (Disulfide bridge: Cys17-Cys22) |
Sequence Short | QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 1 mg/mL (0.25 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.