Shopping Cart
Remove All
Your shopping cart is currently empty
Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $222 | - | In Stock | |
| 5 mg | $662 | - | In Stock | |
| 10 mg | $1,120 | - | In Stock | |
| 25 mg | $1,980 | - | In Stock | |
| 50 mg | $3,290 | - | In Stock |
| Description | Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM). |
| In vitro | Methods: Dulaglutide (50, 100 nM, 24 hours) was used to treat Homo sapiens aortic endothelial cells (HAECs) to investigate the effects of dulaglutide on ox-LDL-induced inflammatory response and monocyte adhesion in Homo sapiens aortic endothelial cells (HAECs). Result: Dulaglutide reduced monocyte adhesion to endothelial cells by inhibiting ox-LDL-induced oxidative stress, inflammatory response, and the expression of adhesion molecules.[1] |
| In vivo | Methods: Dulaglutide (0.6 mg/kg, once weekly for 10 weeks) was administered intraperitoneally to db/db mice to examine the effects of dulaglutide on diabetic sarcopenia. Results: Dulaglutide alleviated muscle tissue damage in db/db mice, lowered levels of inflammatory factors (IL-1β, IL-6, CCL2, and CXCL1), and reversed the decline in FNDC5 levels.[2] |
| Synonyms | LL-37, Human TFA (154947-66-7 free base) |
| Cas No. | 923950-08-7 |
| Color | Transparent |
| Appearance | Liquid |
| Sequence | H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly-OH |
| Sequence Short | HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.