Shopping Cart
Remove All
Your shopping cart is currently empty
Dulaglutide (Alias: LL-37, Human TFA (154947-66-7 free base))
Catalog No. T75718 Copy Product Info
Purity: 98%
🥰Excellent
Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).
Dulaglutide
Copy Product Info🥰Excellent
Catalog No. T75718
Alias LL-37, Human TFA (154947-66-7 free base)
Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).
Dulaglutide
Cas No. 923950-08-7
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $222 | - | In Stock | |
| 5 mg | $662 | - | In Stock | |
| 10 mg | $1,120 | - | In Stock | |
| 25 mg | $1,980 | - | In Stock | |
| 50 mg | $3,290 | - | In Stock |
In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:98%
Appearance:Liquid
Color:Transparent
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM). |
| In vitro | Methods: Dulaglutide (50, 100 nM, 24 hours) was used to treat Homo sapiens aortic endothelial cells (HAECs) to investigate the effects of dulaglutide on ox-LDL-induced inflammatory response and monocyte adhesion in Homo sapiens aortic endothelial cells (HAECs). Result: Dulaglutide reduced monocyte adhesion to endothelial cells by inhibiting ox-LDL-induced oxidative stress, inflammatory response, and the expression of adhesion molecules.[1] |
| In vivo | Methods: Dulaglutide (0.6 mg/kg, once weekly for 10 weeks) was administered intraperitoneally to db/db mice to examine the effects of dulaglutide on diabetic sarcopenia. Results: Dulaglutide alleviated muscle tissue damage in db/db mice, lowered levels of inflammatory factors (IL-1β, IL-6, CCL2, and CXCL1), and reversed the decline in FNDC5 levels.[2] |
| Synonyms | LL-37, Human TFA (154947-66-7 free base) |
| Cas No. | 923950-08-7 |
| Sequence | H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly-OH |
| Sequence Short | HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Calculator
In Vivo Formulation Calculator (Clear solution)
Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, and a total of 10 animals are to be administered, using a formulation of 
10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.Stock Solution Preparation:
Dissolve 2 mg of the compound in 100 μL DMSO to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
Preparation of the In Vivo Formulation:
1) Add 100 μL of the DMSO stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O and mix thoroughly until a homogeneous solution is obtained.
This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: buy Dulaglutide | purchase Dulaglutide | Dulaglutide cost | order Dulaglutide | Dulaglutide in vivo | Dulaglutide in vitro
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.