Your shopping cart is currently empty

Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $222 | - | In Stock | |
| 5 mg | $662 | - | In Stock | |
| 10 mg | $1,120 | - | In Stock | |
| 25 mg | $1,980 | - | In Stock | |
| 50 mg | $3,290 | - | In Stock |
| Description | Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM). |
| In vitro | Methods: Dulaglutide (50, 100 nM, 24 hours) was used to treat Homo sapiens aortic endothelial cells (HAECs) to investigate the effects of dulaglutide on ox-LDL-induced inflammatory response and monocyte adhesion in Homo sapiens aortic endothelial cells (HAECs). Result: Dulaglutide reduced monocyte adhesion to endothelial cells by inhibiting ox-LDL-induced oxidative stress, inflammatory response, and the expression of adhesion molecules.[1] |
| In vivo | Methods: Dulaglutide (0.6 mg/kg, once weekly for 10 weeks) was administered intraperitoneally to db/db mice to examine the effects of dulaglutide on diabetic sarcopenia. Results: Dulaglutide alleviated muscle tissue damage in db/db mice, lowered levels of inflammatory factors (IL-1β, IL-6, CCL2, and CXCL1), and reversed the decline in FNDC5 levels.[2] |
| Synonyms | LL-37, Human TFA (154947-66-7 free base) |
| Cas No. | 923950-08-7 |
| Sequence | H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly-OH |
| Sequence Short | HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.