Shopping Cart
- Remove All
Your shopping cart is currently empty
Endogenous central calcitonin (CT) receptor agonist that stimulates cAMP formation at a potency 350-fold greater than CT (ED50 values are 0.2 and 71 nM respectively). Displays no activity at calcitonin-gene related peptide (CGRP) and adrenomedullin receptors. Inhibits formation of multinuclear osteoclasts with similar efficacy to CT in vitro. Suppresses food intake and increases body temperature in free-feeding rats, and significantly decreases plasma calcium levels in vivo.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $513 | Backorder |
| Description | Endogenous central calcitonin (CT) receptor agonist that stimulates cAMP formation at a potency 350-fold greater than CT (ED50 values are 0.2 and 71 nM respectively). Displays no activity at calcitonin-gene related peptide (CGRP) and adrenomedullin receptors. Inhibits formation of multinuclear osteoclasts with similar efficacy to CT in vitro. Suppresses food intake and increases body temperature in free-feeding rats, and significantly decreases plasma calcium levels in vivo. |
| Molecular Weight | 4098.88 |
| Formula | C175H294N54O49S5 |
| Cas No. | 697327-12-1 |
| Relative Density. | no data available |
| Sequence | Ser-Cys-Asn-Thr-Ala-Thr-Cys-Met-Thr-His-Arg-Leu-Val-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Ser-Met-Val-Arg-Ser-Asn-Leu-Leu-Pro-Thr-Lys-Met-Gly-Phe-Lys-Val-Phe-Gly-NH2 (Disulfide bridge: Cys2-Cys7) |
| Sequence Short | SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG-NH2 (Disulfide bridge: Cys2-Cys7) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
| Solubility Information | 10% acetonitrile / water: 0.5 mg/mL (0.12 mM), Sonication is recommended. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.