Shopping Cart
- Remove All
- Your shopping cart is currently empty
Chlorotoxin(linear) is a linear 36 amino-acid peptide used in Chlorotoxin-related research. Found in the venom of the Egyptian scorpion Leiurus quinquestriatus, it functions as a chloride channel blocker.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $207 | Backorder | |
5 mg | $445 | Backorder | |
10 mg | $643 | Backorder | |
25 mg | $1,341 | Backorder |
Description | Chlorotoxin(linear) is a linear 36 amino-acid peptide used in Chlorotoxin-related research. Found in the venom of the Egyptian scorpion Leiurus quinquestriatus, it functions as a chloride channel blocker. |
Molecular Weight | 4004.76 |
Formula | C158H256N52O48S11 |
Relative Density. | 1.31g/cm3 |
Sequence | Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 |
Sequence Short | MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
Solubility Information | DMSO: 100 mg/mL (24.97 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
DMSO
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.