Shopping Cart

Remove All

Your shopping cart is currently empty

Proceed to checkout Continue shopping

Chlorotoxin(linear)

Name: Chlorotoxin(linear)
Brand: TargetMol
SKU: TP1285
Rating: 4.5 (1 reviews)

😃Good

Catalog No. TP1285

Chlorotoxin(linear) is a linear 36 amino-acid peptide used in Chlorotoxin-related research. Found in the venom of the Egyptian scorpion Leiurus quinquestriatus, it functions as a chloride channel blocker.

Chlorotoxin(linear)

😃Good

Catalog No. TP1285

Pack Size	Price	USA Warehouse	Global Warehouse
1 mg	$207	Inquiry	Inquiry
5 mg	$445	Inquiry	Inquiry
10 mg	$643	Inquiry	Inquiry
25 mg	$1,341	Inquiry	Inquiry

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

Product Introduction

Bioactivity

Description

Chemical Properties

Molecular Weight	4004.76
Formula	C₁₅₈H₂₅₆N₅₂O₄₈S₁₁
Relative Density.	1.31g/cm3
Sequence	Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2
Sequence Short	MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2

Storage & Solubility Information

Storage

keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

DMSO: 100 mg/mL (24.97 mM), Sonication is recommended.

Solution Preparation Table

DMSO

	1mg	5mg	10mg	50mg
1 mM	0.2497 mL	1.2485 mL	2.4970 mL	12.4851 mL
5 mM	0.0499 mL	0.2497 mL	0.4994 mL	2.4970 mL
10 mM	0.0250 mL	0.1249 mL	0.2497 mL	1.2485 mL
20 mM	0.0125 mL	0.0624 mL	0.1249 mL	0.6243 mL

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:

For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments

A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent

DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH₂O. So your working solution concentration is 2 mg/mL。

Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO TargetMol | reagent

(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.

Preparation method for in vivo formula: Take 50 μL DMSO TargetMol | reagent

main solution, add 300 μLPEG300 TargetMol | reagent

mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH₂O TargetMol | reagent

mix well and clarify

For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.

All types of co-solvents required for the protocol, such asDMSO, PEG300/ PEG400, Tween 80, SBE-β-CD, corn oil are available for purchase on the TargetMol website with a simple click.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc