Shopping Cart
Remove All
Your shopping cart is currently empty
Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $126 | Backorder | Backorder | |
| 5 mg | $387 | Backorder | Backorder | |
| 10 mg | $643 | Backorder | Backorder |
| Description | Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. |
| Molecular Weight | 3834.74 |
| Formula | C176H302N52O41S |
| Cas No. | 80451-05-4 |
| Relative Density. | no data available |
| Sequence | Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 |
| Sequence Short | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||
| Solubility Information | H2O: 20 mg/mL (5.22 mM), Sonication and heating are recommended. | |||||||||||||||
Solution Preparation Table | ||||||||||||||||
H2O
| ||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.