Your shopping cart is currently empty

CART (1-39), Human, Rat is a neuropeptide comprising the first 39 residues of the CART peptide. This compound acts as a rat satiety factor with significant appetite-suppressing effects and is closely associated with leptin and neuropeptide Y. It inhibits regular and starvation-induced feeding and can induce anxiety and stress-related behaviors [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | CART (1-39), Human, Rat is a neuropeptide comprising the first 39 residues of the CART peptide. This compound acts as a rat satiety factor with significant appetite-suppressing effects and is closely associated with leptin and neuropeptide Y. It inhibits regular and starvation-induced feeding and can induce anxiety and stress-related behaviors [1]. |
| Molecular Weight | 4369.76 |
| Formula | C188H303N57O63 |
| Sequence | Gly-Leu-Pro-Glu-Asp-Ala-Glu-Leu-Gln-Pro-Arg-Ala-Leu-Asp-Ile-Tyr-Ser-Ala-Val-Asp-Asp-Ala-Ser-His-Glu-Lys-Glu-Leu-Pro-Arg-Arg-Gln-Leu-Arg-Ala-Pro-Gly-Ala-Val-Leu-Gln |
| Sequence Short | {Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.