Shopping Cart
- Remove All
- Your shopping cart is currently empty
CART (1-39), Human, Rat is a neuropeptide comprising the first 39 residues of the CART peptide. This compound acts as a rat satiety factor with significant appetite-suppressing effects and is closely associated with leptin and neuropeptide Y. It inhibits regular and starvation-induced feeding and can induce anxiety and stress-related behaviors [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | CART (1-39), Human, Rat is a neuropeptide comprising the first 39 residues of the CART peptide. This compound acts as a rat satiety factor with significant appetite-suppressing effects and is closely associated with leptin and neuropeptide Y. It inhibits regular and starvation-induced feeding and can induce anxiety and stress-related behaviors [1]. |
Molecular Weight | 4369.76 |
Formula | C188H303N57O63 |
Sequence Short | {Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.