Shopping Cart

Remove All
Your shopping cart is currently empty

Calcitonin, eel

Name: Calcitonin, eel
Brand: TargetMol
SKU: TP1028
Rating: 4.5 (1 reviews)

😃Good

Catalog No. TP1028Cas No. 57014-02-5

Alias Thyrocalcitonin eel

Calcitonin, eel is a peptide hormone that plays a crucial role in maintaining calcium balance within the body. It is extensively utilized in the scientific investigation of postmenopausal osteoporosis, a condition characterized by decreased bone density and an increased risk of fractures in women after menopause.

Calcitonin, eel

😃Good

Catalog No. TP1028Alias Thyrocalcitonin eelCas No. 57014-02-5

Pack Size	Price	Availability
1 mg	TBD	35 days
5 mg	TBD	35 days
10 mg	TBD	35 days

Bulk & Custom

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

Product Introduction

Bioactivity

Description	Calcitonin, eel is a peptide hormone that plays a crucial role in maintaining calcium balance within the body. It is extensively utilized in the scientific investigation of postmenopausal osteoporosis, a condition characterized by decreased bone density and an increased risk of fractures in women after menopause.
Alias	Thyrocalcitonin eel

Chemical Properties

Molecular Weight	3414.91
Formula	C₁₄₆H₂₄₁N₄₃O₄₇S₂
Cas No.	57014-02-5
Relative Density.	1.52 g/cm3 (Predicted)
Sequence	Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Sequence Short	CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)

Storage & Solubility Information

Storage	keep away from moisture \| Powder: -20°C for 3 years \| In solvent: -80°C for 1 year \| Shipping with blue ice/Shipping at ambient temperature.
Solubility Information	H2O: Soluble

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:

For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments

A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent

DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH₂O. So your working solution concentration is 2 mg/mL。

Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO TargetMol | reagent

(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.

Preparation method for in vivo formula: Take 50 μL DMSO TargetMol | reagent

main solution, add 300 μLPEG300 TargetMol | reagent

mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH₂O TargetMol | reagent

mix well and clarify

For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Sci Citations

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Calcitonin, eel