Shopping Cart

Your shopping cart is currently empty

Calcitonin eel acetate

Name: Calcitonin eel acetate
Brand: TargetMol
SKU: TP1028L
Price: 148 USD
Availability: InStock
Rating: 5 (10 reviews)

Copy Product Info

🥰Excellent

Catalog No. TP1028L

Alias Thyrocalcitonin eel, Calcitonin eel acetate (57014-02-5 Free base)

Calcitonin eel acetate (Calcitonin eel acetate (57014-02-5 Free base)) is the regulation of calcium homeostasis thyroid hormone peptide.

Calcitonin eel acetate

Copy Product Info

🥰Excellent

Purity: 98.54%

Catalog No. TP1028LAlias Thyrocalcitonin eel, Calcitonin eel acetate (57014-02-5 Free base)

Calcitonin eel acetate (Calcitonin eel acetate (57014-02-5 Free base)) is the regulation of calcium homeostasis thyroid hormone peptide.

Pack Size	Price	USA Warehouse	Global Warehouse
1 mg	$148	In Stock	In Stock
5 mg	$336	In Stock	In Stock
10 mg	$497	In Stock	In Stock
25 mg	$793	In Stock	In Stock
50 mg	$1,130	In Stock	In Stock
100 mg	$1,520	In Stock	In Stock

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Batch Information

Select Batch

Purity:98.54%

Appearance:Solid

Color:White

Resource Download

COA HPLC MS

Product Introduction

Bioactivity

Description	Calcitonin eel acetate (Calcitonin eel acetate (57014-02-5 Free base)) is the regulation of calcium homeostasis thyroid hormone peptide.
In vitro	Eel calcitonin and its analog were always more potent than salmon calcitonin, but the efficacy of the three polypeptides was comparable. In cultured anterior pituitary cells, the inhibitory effect on phosphoinositide hydrolysis observed after chronic treatment with calcitonin was accompanied by a reduction of prolactin release. In contrast, a single treatment of cultured anterior pituitary cells with eel calcitonin or its analog eel calcitonin induced an increase of inositol phosphate accumulation, while salmon calcitonin was inactive. Accordingly, eel and eel calcitonin, but not salmon calcitonin, induced a slight but significant stimulation of prolactin secretion[1].
Synonyms	Thyrocalcitonin eel, Calcitonin eel acetate (57014-02-5 Free base)

Chemical Properties

Molecular Weight	3474.96
Formula	C₁₄₈H₂₄₅N₄₃O₄₉S₂
Smiles	OC(C=C1)=CC=C1C[C@H](NC([C@H]([C@H](O)C)NC([C@H](CCC(N)=O)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC([C@@H](NC([C@H](CC(C)C)NC([C@H](CCC(O)=O)NC([C@H](CCC(N)=O)NC([C@H](CO)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC(CNC([C@H](CC(C)C)NC([C@H](C(C)C)NC([C@H]2NC([C@](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CSSC2)N)=O)CO)=O)CC(N)=O)=O)CC(C)C)=O)CO)=O)([H])[C@H](O)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CN=CN3)=O)=O)=O)=O)=O)C(N4[C@@H](CCC4)C(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(NCC(N[C@@H](C)C(NCC(N[C@@H]([C@H](O)C)C(N5[C@@H](CCC5)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O.CC(O)=O
Relative Density.	no data available
Sequence	Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Cys1-Cys7).CH3CO2H
Sequence Short	CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP (C1-C7)

Storage & Solubility Information

Storage

keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

H2O: 100 mg/mL (28.78 mM), Sonication and heating are recommended.

Solution Preparation Table

H2O

	1mg	5mg	10mg	50mg
1 mM	0.2878 mL	1.4389 mL	2.8777 mL	14.3887 mL
5 mM	0.0576 mL	0.2878 mL	0.5755 mL	2.8777 mL
10 mM	0.0288 mL	0.1439 mL	0.2878 mL	1.4389 mL
20 mM	0.0144 mL	0.0719 mL	0.1439 mL	0.7194 mL

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc