Your shopping cart is currently empty

Calcitonin eel acetate (Calcitonin eel acetate (57014-02-5 Free base)) is the regulation of calcium homeostasis thyroid hormone peptide.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $148 | In Stock | In Stock | |
| 5 mg | $336 | In Stock | In Stock | |
| 10 mg | $497 | In Stock | In Stock | |
| 25 mg | $793 | In Stock | In Stock | |
| 50 mg | $1,130 | In Stock | In Stock | |
| 100 mg | $1,520 | In Stock | In Stock |
| Description | Calcitonin eel acetate (Calcitonin eel acetate (57014-02-5 Free base)) is the regulation of calcium homeostasis thyroid hormone peptide. |
| In vitro | Eel calcitonin and its analog were always more potent than salmon calcitonin, but the efficacy of the three polypeptides was comparable. In cultured anterior pituitary cells, the inhibitory effect on phosphoinositide hydrolysis observed after chronic treatment with calcitonin was accompanied by a reduction of prolactin release. In contrast, a single treatment of cultured anterior pituitary cells with eel calcitonin or its analog eel calcitonin induced an increase of inositol phosphate accumulation, while salmon calcitonin was inactive. Accordingly, eel and eel calcitonin, but not salmon calcitonin, induced a slight but significant stimulation of prolactin secretion[1]. |
| Synonyms | Thyrocalcitonin eel, Calcitonin eel acetate (57014-02-5 Free base) |
| Molecular Weight | 3474.96 |
| Formula | C148H245N43O49S2 |
| Smiles | OC(C=C1)=CC=C1C[C@H](NC([C@H]([C@H](O)C)NC([C@H](CCC(N)=O)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC([C@@H](NC([C@H](CC(C)C)NC([C@H](CCC(O)=O)NC([C@H](CCC(N)=O)NC([C@H](CO)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC(CNC([C@H](CC(C)C)NC([C@H](C(C)C)NC([C@H]2NC([C@](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CSSC2)N)=O)CO)=O)CC(N)=O)=O)CC(C)C)=O)CO)=O)([H])[C@H](O)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CN=CN3)=O)=O)=O)=O)=O)C(N4[C@@H](CCC4)C(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(NCC(N[C@@H](C)C(NCC(N[C@@H]([C@H](O)C)C(N5[C@@H](CCC5)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O.CC(O)=O |
| Relative Density. | no data available |
| Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Cys1-Cys7).CH3CO2H |
| Sequence Short | CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP (C1-C7) |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | H2O: 100 mg/mL (28.78 mM), Sonication and heating are recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | ||||||||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.