Shopping Cart
- Remove All
- Your shopping cart is currently empty
Calcitonin eel acetate (Calcitonin eel acetate (57014-02-5 Free base)) is the regulation of calcium homeostasis thyroid hormone peptide.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $148 | In Stock | |
5 mg | $336 | In Stock | |
10 mg | $497 | In Stock | |
25 mg | $793 | In Stock | |
50 mg | $1,130 | In Stock | |
100 mg | $1,520 | In Stock |
Description | Calcitonin eel acetate (Calcitonin eel acetate (57014-02-5 Free base)) is the regulation of calcium homeostasis thyroid hormone peptide. |
In vitro | Eel calcitonin and its analog were always more potent than salmon calcitonin, but the efficacy of the three polypeptides was comparable. In cultured anterior pituitary cells, the inhibitory effect on phosphoinositide hydrolysis observed after chronic treatment with calcitonin was accompanied by a reduction of prolactin release. In contrast, a single treatment of cultured anterior pituitary cells with eel calcitonin or its analog eel calcitonin induced an increase of inositol phosphate accumulation, while salmon calcitonin was inactive. Accordingly, eel and eel calcitonin, but not salmon calcitonin, induced a slight but significant stimulation of prolactin secretion[1]. |
Synonyms | Thyrocalcitonin eel, Calcitonin eel acetate (57014-02-5 Free base) |
Molecular Weight | 3474.96 |
Formula | C148H245N43O49S2 |
Smiles | OC(C=C1)=CC=C1C[C@H](NC([C@H]([C@H](O)C)NC([C@H](CCC(N)=O)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC([C@@H](NC([C@H](CC(C)C)NC([C@H](CCC(O)=O)NC([C@H](CCC(N)=O)NC([C@H](CO)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC(CNC([C@H](CC(C)C)NC([C@H](C(C)C)NC([C@H]2NC([C@](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CSSC2)N)=O)CO)=O)CC(N)=O)=O)CC(C)C)=O)CO)=O)([H])[C@H](O)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CN=CN3)=O)=O)=O)=O)=O)C(N4[C@@H](CCC4)C(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(NCC(N[C@@H](C)C(NCC(N[C@@H]([C@H](O)C)C(N5[C@@H](CCC5)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O.CC(O)=O |
Relative Density. | no data available |
Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Cys1-Cys7).CH3CO2H |
Sequence Short | CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP (C1-C7) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
Solubility Information | H2O: 100 mg/mL (28.78 mM), Sonication and heating are recommended. ![]() | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.