Your shopping cart is currently empty

Bulevirtide acetate is a viral particle entry inhibitor that blocks the hepatocyte entry pathway for viral particles, the hepatic sodium/taurine co-transport polypeptide (NTCP) receptor. It can be used in HBV and HDV infection studies.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $197 | In Stock | In Stock | |
| 5 mg | $419 | In Stock | In Stock | |
| 10 mg | $622 | In Stock | In Stock | |
| 25 mg | $992 | In Stock | In Stock | |
| 50 mg | $1,330 | In Stock | In Stock | |
| 100 mg | $1,780 | In Stock | In Stock |
| Description | Bulevirtide acetate is a viral particle entry inhibitor that blocks the hepatocyte entry pathway for viral particles, the hepatic sodium/taurine co-transport polypeptide (NTCP) receptor. It can be used in HBV and HDV infection studies. |
| In vitro | METHODS: Bulevirtide acetate (50-200nM) was used to treat U2OS-HA-hNTCP cells, and plasma membrane-resident NTCP was labeled with biotin- or fluorescein isothiocyanate (FITC)-labeled Bulevirtide acetate and hNTCP overexpressing U2OS cells were used for timely Tracking. Förster resonance energy transfer was performed using fluorescence lifetime imaging microscopy to investigate whether Bulevirtide acetate could be transferred to newly synthesized NTCP.
RESULTS Bulevirtide acetate (50-200 nM, 24 h) binds NTCP by non-covalent binding and inhibits NTCP in a time- and dose-dependent manner, while transferring to newly synthesized NTCP molecules. [1] METHODS: LS180 cells were treated with medium containing Bulevirtide acetate (0.5, 1, 5, and 10 µM) for 4 consecutive times for 4 consecutive days, and fluorescent substrates were used to detect overexpression of p -glycoproteins (P-gp, ABCB1), Breast Cancer Resistance Proteins (BCRP/ABCG2), and Organic Anion Transport Polypeptides 1B1 and 1B3 (OATP1B1/SLCO1B1 and OATP1B3/SLCO1B3) in cells inhibiting p -glycoprotein (P-gp, ABCB1), breast cancer resistance protein (BCRP/ABCG2). RESULTS Bulevirtide acetate inhibited two uptake transporter proteins, OATP1B1 and OATP1B3, with IC50 values of 0.5 and 8.7 µM, respectively.[2] |
| In vivo | METHODS: Mice were treated with Bulevirtide acetate (2.5 mg/kg) by a single subcutaneous injection, and 20 μl of blood was withdrawn to measure plasma bile acid levels.
RESULTS Peak plasma bile salt concentration was reached 4 hours after Bulevirtide acetate administration, and plasma bile salt levels were completely normalized 24 hours later, consistent with NTCP-mediated restoration of bile acid transport in vitro. [1] METHODS: Humanized uPA/SCID mice were injected subcutaneously with 2 μg/g body weight of Bulevirtide acetate 3 days or 3 weeks after HBV inoculation, and the treatment duration was 3 or 6 weeks. RESULTS Bulevirtide acetate effectively prevented virus transmission from initially infected human hepatocytes and also effectively blocked HBV transmission. [3] |
| Molecular Weight | 5458.91 |
| Formula | C236H333N65O73 |
| Relative Density. | no data available |
| Sequence | myristoyl-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 |
| Sequence Short | GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG |
| Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: Insoluble DMSO: 100 mg/mL (18.32 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.