Your shopping cart is currently empty

Bulevirtide, also known by its developmental code name Myrcludex B, is a synthetic lipopeptide inhibitor of the sodium taurocholate cotransporting polypeptide (NTCP) that effectively inhibits the cellular entry of both hepatitis B virus (HBV) and hepatitis D virus (HDV) into hepatocytes, even in cases of compensated cirrhosis, showing significant potential for the treatment of chronic hepatitis D.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | $499 | Inquiry | Inquiry |
| Description | Bulevirtide, also known by its developmental code name Myrcludex B, is a synthetic lipopeptide inhibitor of the sodium taurocholate cotransporting polypeptide (NTCP) that effectively inhibits the cellular entry of both hepatitis B virus (HBV) and hepatitis D virus (HDV) into hepatocytes, even in cases of compensated cirrhosis, showing significant potential for the treatment of chronic hepatitis D. |
| Targets&IC50 | NTCP:∼80 pM |
| In vitro | Bulevirtide (2 μM, 9 days) treatment of Huh7-NTCP cells exhibits antiviral activity by inhibiting viral replication and blocking NTCP-mediated upregulation of HBV replication in Huh7-NTCP cells.[3] |
| In vivo | Methods: Bulevirtide (2.5 mg/kg, subcutaneous injection, 100 mg/kg) was administered to OATP1a/1b-deficient mice to investigate the plasma bile acid dynamics after Bulevirtide inhibited NTCP. Results: Peak plasma bile salt concentrations were achieved 4 hours after Bulevirtide administration (Figure 1A), at which time most Bulevirtide had been cleared from the circulation. [2] |
| Synonyms | Myrcludex B, MyrB |
| Molecular Weight | 5398.86 |
| Formula | C248H355N65O72 |
| Cas No. | 2012558-47-1 |
| Smiles | NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](C)NC([C@@H](NC([C@@H]1CCCN1C([C@H](CC2=CNC3=C2C=CC=C3)NC([C@H](CC4=CN=CN4)NC([C@H](CC(O)=O)NC([C@@H](NC([C@@H](NC([C@@H]5CCCN5C([C@@H](NC([C@H](CC6=CC=CC=C6)NC([C@H](CC(O)=O)NC([C@H](CC7=CNC8=C7C=CC=C8)NC([C@H](CC(O)=O)NC([C@@H]9CCCN9C([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](C)NC(CNC([C@H](CC%10=CC=CC=C%10)NC([C@H](C)NC([C@@H]%11CCCN%11C([C@H](CC(O)=O)NC([C@@H](NC([C@@H](NC([C@H](CC%12=CN=CN%12)NC([C@H](CC(O)=O)NC([C@@H]%13CCCN%13C([C@H](CC%14=CC=CC=C%14)NC([C@H](CC%15=CC=CC=C%15)NC(CNC([C@@H](NC([C@@H]%16CCCN%16C([C@@H](NC([C@@H]%17CCCN%17C([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@]([H])(NC(CNC(CCCCCCCCCCCCC)=O)=O)[C@H](O)C)=O)CC(N)=O)=O)CC(C)C)=O)CO)=O)C(C)C)=O)=O)CC(N)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)CCC(N)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)CC(N)=O)=O)CO)=O)CC(N)=O)=O)CC(N)=O)=O)=O)=O)=O)=O)=O)CC(N)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)=O)=O)=O)=O)CCC(O)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)C(C)C)=O)=O |
| Sequence | {Myr}-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 |
| Sequence Short | {Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG |
| Storage | keep away from moisture,keep away from direct sunlight | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | H2O: 65 mg/mL (12.04 mM), when pH is adjusted to 8 with NH3·H2O. Sonication is recommended. DMSO: 40 mg/mL (7.41 mM), Sonication is recommended. | |||||||||||||||||||||||||
| In Vivo Formulation | 10% DMSO+90% Corn Oil: 2 mg/mL (0.37 mM), Sonication is recommended. Please add the solvents sequentially, clarifying the solution as much as possible before adding the next one. Dissolve by heating and/or sonication if necessary. Working solution is recommended to be prepared and used immediately. The formulation provided above is for reference purposes only. In vivo formulations may vary and should be modified based on specific experimental conditions. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
DMSO/H2O
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | ||||||||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.