Contact UsQuotation
Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty
Proceed to checkoutContinue shopping
TOPBioactivityChemical infoStorage&SolubilityCalculator

Bulevirtide

🥰Excellent
Catalog No. T35373Cas No. 2012558-47-1
Alias Myrcludex B, MyrB

Bulevirtide, also known by its developmental code name Myrcludex B, is a synthetic lipopeptide inhibitor of the sodium taurocholate cotransporting polypeptide (NTCP) that effectively inhibits the cellular entry of both hepatitis B virus (HBV) and hepatitis D virus (HDV) into hepatocytes, even in cases of compensated cirrhosis, showing significant potential for the treatment of chronic hepatitis D.

Bulevirtide
Other Forms of Bulevirtide:
Bulevirtide acetateT35373L
In Stock
View details

Bulevirtide

🥰Excellent
Catalog No. T35373Alias Myrcludex B, MyrBCas No. 2012558-47-1
Bulevirtide, also known by its developmental code name Myrcludex B, is a synthetic lipopeptide inhibitor of the sodium taurocholate cotransporting polypeptide (NTCP) that effectively inhibits the cellular entry of both hepatitis B virus (HBV) and hepatitis D virus (HDV) into hepatocytes, even in cases of compensated cirrhosis, showing significant potential for the treatment of chronic hepatitis D.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 mg$499-In Stock
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
TargetMol
View More

Batch Information

Select Batch
Contact us for more batch information

Resource Download

COA

Product Introduction

Bioactivity
Description
Bulevirtide, also known by its developmental code name Myrcludex B, is a synthetic lipopeptide inhibitor of the sodium taurocholate cotransporting polypeptide (NTCP) that effectively inhibits the cellular entry of both hepatitis B virus (HBV) and hepatitis D virus (HDV) into hepatocytes, even in cases of compensated cirrhosis, showing significant potential for the treatment of chronic hepatitis D.
Targets&IC50
NTCP:∼80 pM
In vitro
Bulevirtide (2 μM, 9 days) treatment of Huh7-NTCP cells exhibits antiviral activity by inhibiting viral replication and blocking NTCP-mediated upregulation of HBV replication in Huh7-NTCP cells.[3]
In vivo
Methods: Bulevirtide (2.5 mg/kg, subcutaneous injection, 100 mg/kg) was administered to OATP1a/1b-deficient mice to investigate the plasma bile acid dynamics after Bulevirtide inhibited NTCP.
Results: Peak plasma bile salt concentrations were achieved 4 hours after Bulevirtide administration (Figure 1A), at which time most Bulevirtide had been cleared from the circulation. [2]
SynonymsMyrcludex B, MyrB
Chemical Properties
Molecular Weight5398.86
FormulaC248H355N65O72
Cas No.2012558-47-1
SmilesNC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](C)NC([C@@H](NC([C@@H]1CCCN1C([C@H](CC2=CNC3=C2C=CC=C3)NC([C@H](CC4=CN=CN4)NC([C@H](CC(O)=O)NC([C@@H](NC([C@@H](NC([C@@H]5CCCN5C([C@@H](NC([C@H](CC6=CC=CC=C6)NC([C@H](CC(O)=O)NC([C@H](CC7=CNC8=C7C=CC=C8)NC([C@H](CC(O)=O)NC([C@@H]9CCCN9C([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](C)NC(CNC([C@H](CC%10=CC=CC=C%10)NC([C@H](C)NC([C@@H]%11CCCN%11C([C@H](CC(O)=O)NC([C@@H](NC([C@@H](NC([C@H](CC%12=CN=CN%12)NC([C@H](CC(O)=O)NC([C@@H]%13CCCN%13C([C@H](CC%14=CC=CC=C%14)NC([C@H](CC%15=CC=CC=C%15)NC(CNC([C@@H](NC([C@@H]%16CCCN%16C([C@@H](NC([C@@H]%17CCCN%17C([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@]([H])(NC(CNC(CCCCCCCCCCCCC)=O)=O)[C@H](O)C)=O)CC(N)=O)=O)CC(C)C)=O)CO)=O)C(C)C)=O)=O)CC(N)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)CCC(N)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)CC(N)=O)=O)CO)=O)CC(N)=O)=O)CC(N)=O)=O)=O)=O)=O)=O)=O)CC(N)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)=O)=O)=O)=O)CCC(O)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)C(C)C)=O)=O
Sequence{Myr}-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2
Sequence Short{Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2
Storage & Solubility Information
Storagekeep away from moisture,keep away from direct sunlight | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.
Solubility Information
H2O: 65 mg/mL (12.04 mM), when pH is adjusted to 8 with NH3·H2O. Sonication is recommended.
DMSO: 40 mg/mL (7.41 mM), Sonication is recommended.
In Vivo Formulation
10% DMSO+90% Corn Oil: 2 mg/mL (0.37 mM), Sonication is recommeded.
Please add the solvents sequentially, clarifying the solution as much as possible before adding the next one. Dissolve by heating and/or sonication if necessary. Working solution is recommended to be prepared and used immediately. The formulation provided above is for reference purposes only. In vivo formulations may vary and should be modified based on specific experimental conditions.
Solution Preparation Table
DMSO/H2O
1mg5mg10mg50mg
1 mM0.1852 mL0.9261 mL1.8522 mL9.2612 mL
5 mM0.0370 mL0.1852 mL0.3704 mL1.8522 mL
H2O
1mg5mg10mg50mg
10 mM0.0185 mL0.0926 mL0.1852 mL0.9261 mL

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:
TargetMol | Animal experimentsFor example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH2O. So your working solution concentration is 2 mg/mL。
Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSOTargetMol | reagent (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
Preparation method for in vivo formula: Take 50 μL DMSOTargetMol | reagent main solution, add 300 μLPEG300TargetMol | reagent mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH2OTargetMol | reagent mix well and clarify
For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.
All types of co-solvents required for the protocol, such asDMSO, PEG300/ PEG400, Tween 80, SBE-β-CD, corn oil are available for purchase on the TargetMol website with a simple click.
1 Enter information below:
mg/kg
g
μL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Bulevirtide (Myrcludex B)Bulevirtide
Related Tags: buy Bulevirtide | purchase Bulevirtide | Bulevirtide cost | order Bulevirtide | Bulevirtide chemical structure | Bulevirtide in vivo | Bulevirtide in vitro | Bulevirtide formula | Bulevirtide molecular weight
TargetMol | Logo

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.