Shopping Cart

Remove All
Your shopping cart is currently empty

Bulevirtide

Name: Bulevirtide
Brand: TargetMol
SKU: T35373
Price: 499 USD
Availability: InStock
Rating: 5 (10 reviews)

🥰Excellent

Catalog No. T35373Cas No. 2012558-47-1

Alias Myrcludex B, MyrB

Bulevirtide, also known by its developmental code name Myrcludex B, is a synthetic lipopeptide inhibitor of the sodium taurocholate cotransporting polypeptide (NTCP) that effectively inhibits the cellular entry of both hepatitis B virus (HBV) and hepatitis D virus (HDV) into hepatocytes, even in cases of compensated cirrhosis, showing significant potential for the treatment of chronic hepatitis D.

Bulevirtide

🥰Excellent

Catalog No. T35373Alias Myrcludex B, MyrBCas No. 2012558-47-1

Pack Size	Price	Availability	Quantity
5 mg	$499	In Stock

Add to Cart

Add to Quotation

Bulk & Custom

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Batch Information

Select Batch

Resource Download

COA

Product Introduction

Bioactivity

Description	Bulevirtide, also known by its developmental code name Myrcludex B, is a synthetic lipopeptide inhibitor of the sodium taurocholate cotransporting polypeptide (NTCP) that effectively inhibits the cellular entry of both hepatitis B virus (HBV) and hepatitis D virus (HDV) into hepatocytes, even in cases of compensated cirrhosis, showing significant potential for the treatment of chronic hepatitis D.
Targets&IC50	NTCP:∼80 pM
In vitro	Bulevirtide (2 μM, 9 days) treatment of Huh7-NTCP cells exhibits antiviral activity by inhibiting viral replication and blocking NTCP-mediated upregulation of HBV replication in Huh7-NTCP cells.[3]
In vivo	Methods: Bulevirtide (2.5 mg/kg, subcutaneous injection, 100 mg/kg) was administered to OATP1a/1b-deficient mice to investigate the plasma bile acid dynamics after Bulevirtide inhibited NTCP. Results: Peak plasma bile salt concentrations were achieved 4 hours after Bulevirtide administration (Figure 1A), at which time most Bulevirtide had been cleared from the circulation. [2]
Synonyms	Myrcludex B, MyrB

Chemical Properties

Molecular Weight	5398.86
Formula	C₂₄₈H₃₅₅N₆₅O₇₂
Cas No.	2012558-47-1
Smiles	NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](C)NC([C@@H](NC([C@@H]1CCCN1C([C@H](CC2=CNC3=C2C=CC=C3)NC([C@H](CC4=CN=CN4)NC([C@H](CC(O)=O)NC([C@@H](NC([C@@H](NC([C@@H]5CCCN5C([C@@H](NC([C@H](CC6=CC=CC=C6)NC([C@H](CC(O)=O)NC([C@H](CC7=CNC8=C7C=CC=C8)NC([C@H](CC(O)=O)NC([C@@H]9CCCN9C([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](C)NC(CNC([C@H](CC%10=CC=CC=C%10)NC([C@H](C)NC([C@@H]%11CCCN%11C([C@H](CC(O)=O)NC([C@@H](NC([C@@H](NC([C@H](CC%12=CN=CN%12)NC([C@H](CC(O)=O)NC([C@@H]%13CCCN%13C([C@H](CC%14=CC=CC=C%14)NC([C@H](CC%15=CC=CC=C%15)NC(CNC([C@@H](NC([C@@H]%16CCCN%16C([C@@H](NC([C@@H]%17CCCN%17C([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@]([H])(NC(CNC(CCCCCCCCCCCCC)=O)=O)[C@H](O)C)=O)CC(N)=O)=O)CC(C)C)=O)CO)=O)C(C)C)=O)=O)CC(N)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)CCC(N)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)CC(N)=O)=O)CO)=O)CC(N)=O)=O)CC(N)=O)=O)=O)=O)=O)=O)=O)CC(N)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)=O)=O)=O)=O)CCC(O)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)C(C)C)=O)=O
Sequence	{Myr}-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2
Sequence Short	{Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2

Storage & Solubility Information

Storage

keep away from moisture,keep away from direct sunlight | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

H2O: 65 mg/mL (12.04 mM), when pH is adjusted to 8 with NH3·H2O. Sonication is recommended.

DMSO: 40 mg/mL (7.41 mM), Sonication is recommended.

Solution Preparation Table

DMSO/H2O

	1mg	5mg	10mg	50mg
1 mM	0.1852 mL	0.9261 mL	1.8522 mL	9.2612 mL
5 mM	0.0370 mL	0.1852 mL	0.3704 mL	1.8522 mL

H2O

	1mg	5mg	10mg	50mg
10 mM	0.0185 mL	0.0926 mL	0.1852 mL	0.9261 mL

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:

For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments

A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent

DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH₂O. So your working solution concentration is 2 mg/mL。

Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO TargetMol | reagent

(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.

Preparation method for in vivo formula: Take 50 μL DMSO TargetMol | reagent

main solution, add 300 μLPEG300 TargetMol | reagent

mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH₂O TargetMol | reagent

mix well and clarify

For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Sci Citations

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc