Shopping Cart
- Remove All
- Your shopping cart is currently empty
BMAP-28, an antibiotic peptide, induces cell death by triggering the mitochondrial permeability transition pore and serves as a research tool in the study of microbial infections and cancer [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | BMAP-28, an antibiotic peptide, induces cell death by triggering the mitochondrial permeability transition pore and serves as a research tool in the study of microbial infections and cancer [1]. |
In vitro | BMAP-28 at a concentration of 3 µM and an incubation time of 10 minutes attenuated calcein fluorescence in the mitochondria of U937 cells [1]. Additionally, BMAP-28 induced depolarization of the mitochondrial inner membrane in both single cells and isolated mitochondria [1]. |
Molecular Weight | 3073.81 |
Formula | C145H250N44O29 |
Cas No. | 184870-31-3 |
Sequence | Gly-Gly-Leu-Arg-Ser-Leu-Gly-Arg-Lys-Ile-Leu-Arg-Ala-Trp-Lys-Lys-Tyr-Gly-Pro-Ile-Ile-Val-Pro-Ile-Ile-Arg-Ile-NH2 |
Sequence Short | GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.