Shopping Cart
- Remove All
- Your shopping cart is currently empty
Beinaglutide, a recombinant human GLP-1 (rhGLP-1) polypeptide, exhibits nearly complete homology with human GLP-1 (7–36). It demonstrates dose-dependent effects in improving glycemic control, reducing food intake, delaying gastric emptying, and promoting weight loss. This compound shows promise for research into overweight/obesity and nonalcoholic steatohepatitis (NASH) [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Beinaglutide, a recombinant human GLP-1 (rhGLP-1) polypeptide, exhibits nearly complete homology with human GLP-1 (7–36). It demonstrates dose-dependent effects in improving glycemic control, reducing food intake, delaying gastric emptying, and promoting weight loss. This compound shows promise for research into overweight/obesity and nonalcoholic steatohepatitis (NASH) [1] [2]. |
Molecular Weight | 3298.61 |
Formula | C149H225N39O46 |
Cas No. | 123475-27-4 |
Sequence Short | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.