Your shopping cart is currently empty

BDS-I, a marine toxin derived from Anemonia sulcata, functions as a selective inhibitor of the potassium channel, specifically targeting Kv3.4. It impedes the Aβ1-42-induced augmentation of Kv3.4 activity, caspase-3 activation, and distortion of nuclear morphology in NGF-differentiated PC-12 cells. Moreover, BDS-I effectively counteracts the cell death induced by the Aβ peptide [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | BDS-I, a marine toxin derived from Anemonia sulcata, functions as a selective inhibitor of the potassium channel, specifically targeting Kv3.4. It impedes the Aβ1-42-induced augmentation of Kv3.4 activity, caspase-3 activation, and distortion of nuclear morphology in NGF-differentiated PC-12 cells. Moreover, BDS-I effectively counteracts the cell death induced by the Aβ peptide [1]. |
| Molecular Weight | 4708.34 |
| Formula | C210H297N57O56S6 |
| Cas No. | 207621-38-3 |
| Sequence | Ala-Ala-Pro-Cys-Phe-Cys-Ser-Gly-Lys-Pro-Gly-Arg-Gly-Asp-Leu-Trp-Ile-Leu-Arg-Gly-Thr-Cys-Pro-Gly-Gly-Tyr-Gly-Tyr-Thr-Ser-Asn-Cys-Tyr-Lys-Trp-Pro-Asn-Ile-Cys-Cys-Tyr-Pro-His (Disulfide bonds:Cys4-Cys39, Cys6-Cys32, Cys22-Cys40) |
| Sequence Short | AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH (Disulfide bonds:Cys4-Cys39, Cys6-Cys32, Cys22-Cys40) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.