Shopping Cart
- Remove All
Your shopping cart is currently empty
BDS-I, a marine toxin derived from Anemonia sulcata, functions as a selective inhibitor of the potassium channel, specifically targeting Kv3.4. It impedes the Aβ1-42-induced augmentation of Kv3.4 activity, caspase-3 activation, and distortion of nuclear morphology in NGF-differentiated PC-12 cells. Moreover, BDS-I effectively counteracts the cell death induced by the Aβ peptide [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | BDS-I, a marine toxin derived from Anemonia sulcata, functions as a selective inhibitor of the potassium channel, specifically targeting Kv3.4. It impedes the Aβ1-42-induced augmentation of Kv3.4 activity, caspase-3 activation, and distortion of nuclear morphology in NGF-differentiated PC-12 cells. Moreover, BDS-I effectively counteracts the cell death induced by the Aβ peptide [1]. |
| Molecular Weight | 4708.34 |
| Formula | C210H297N57O56S6 |
| Cas No. | 207621-38-3 |
| Sequence | Ala-Ala-Pro-Cys-Phe-Cys-Ser-Gly-Lys-Pro-Gly-Arg-Gly-Asp-Leu-Trp-Ile-Leu-Arg-Gly-Thr-Cys-Pro-Gly-Gly-Tyr-Gly-Tyr-Thr-Ser-Asn-Cys-Tyr-Lys-Trp-Pro-Asn-Ile-Cys-Cys-Tyr-Pro-His (Disulfide bonds:Cys4-Cys39, Cys6-Cys32, Cys22-Cys40) |
| Sequence Short | AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH (Disulfide bonds:Cys4-Cys39, Cys6-Cys32, Cys22-Cys40) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.