Shopping Cart
- Remove All
- Your shopping cart is currently empty
Agitoxin-2 TFA, a potent inhibitor of K+ channels, exhibits IC50 values of 201 pM and 144 pM for mK V 1.3 and mK V 1.1, respectively [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Agitoxin-2 TFA, a potent inhibitor of K+ channels, exhibits IC50 values of 201 pM and 144 pM for mK V 1.3 and mK V 1.1, respectively [1] [2]. |
Molecular Weight | 4204.89 |
Formula | C171H279F3N54O50S8 |
Sequence Short | GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.