Shopping Cart
- Remove All
- Your shopping cart is currently empty
Potent Shaker K+ channel blocker (Ki = 0.64 nM). Also inhibits Kv1.3, Kv1.6 and Kv1.1 K+ channels (Ki values are 4, 37 and 44 pM respectively).
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | $2,276 | Backorder |
Description | Potent Shaker K+ channel blocker (Ki = 0.64 nM). Also inhibits Kv1.3, Kv1.6 and Kv1.1 K+ channels (Ki values are 4, 37 and 44 pM respectively). |
Synonyms | Agitoxin 2 |
Molecular Weight | 4090.87 |
Formula | C169H278N54O48S8 |
Cas No. | 168147-41-9 |
Relative Density. | no data available |
Sequence | Gly-Val-Pro-Ile-Asn-Val-Ser-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35) |
Sequence Short | GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 1 mg/mL (0.24 mM) |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.