Shopping Cart
- Remove All
- Your shopping cart is currently empty
Adrenotensin (human) (Pro-ADM-153-185 (human)), a 153-185 fragment of the Adrenomedullin precursor peptide, is a 52-amino acid peptide from the CGRP superfamily that plays a diverse role in vasodilation [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Adrenotensin (human) (Pro-ADM-153-185 (human)), a 153-185 fragment of the Adrenomedullin precursor peptide, is a 52-amino acid peptide from the CGRP superfamily that plays a diverse role in vasodilation [1]. |
Molecular Weight | 3219.56 |
Formula | C143H224N42O43 |
Cas No. | 166546-72-1 |
Sequence Short | SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.