Shopping Cart
- Remove All
- Your shopping cart is currently empty
Aa1 toxin, sourced from Androctonus australis Garzoni venom, is a neurotoxic peptide that specifically blocks potassium channels and has applications in neurological disease research [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Aa1 toxin, sourced from Androctonus australis Garzoni venom, is a neurotoxic peptide that specifically blocks potassium channels and has applications in neurological disease research [1]. |
Molecular Weight | 3868.46 |
Formula | C156H260N54O49S6 |
Sequence | Gln-Asn-Glu-Thr-Asn-Lys-Lys-Cys-Gln-Gly-Gly-Ser-Cys-Ala-Ser-Val-Cys-Arg-Arg-Val-Ile-Gly-Val-Ala-Ala-Gly-Lys-Cys-Ile-Asn-Gly-Arg-Cys-Val-Cys-Tyr-Pro (Disulfide bridge: Cys8-Cys28; Cys13-Cys33; Cys17-Cys35) |
Sequence Short | QNETNKKCQGGSCASVCRRVIGVAAGKCINGRCVCYP (Disulfide bridge: Cys8-Cys28; Cys13-Cys33; Cys17-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.