Shopping Cart
- Remove All
- Your shopping cart is currently empty
[Des-His1,Glu9]-Glucagon amide TFA is a potent peptide antagonist of the glucagon receptor with a pA2 value of 7.2, demonstrating potential utility in diabetes pathogenesis research[1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $232 | Backorder | |
5 mg | $697 | Backorder | |
10 mg | $1,120 | Backorder |
Description | [Des-His1,Glu9]-Glucagon amide TFA is a potent peptide antagonist of the glucagon receptor with a pA2 value of 7.2, demonstrating potential utility in diabetes pathogenesis research[1]. |
Synonyms | [Des-His1,Glu9]-Glucagon amide TFA |
Relative Density. | no data available |
Sequence | Ser-Gln-Gly-Thr-Phe-Thr-Ser-Glu-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-NH2 |
Sequence Short | SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.