Shopping Cart
- Remove All
- Your shopping cart is currently empty
Vosoritide (BMN 111), a modified recombinant C-type natriuretic peptide (CNP) analogue, engages with natriuretic peptide receptor type B (NPR-B) to diminish the function of fibroblast growth factor receptor 3 (FGFR3). This compound is employed in the study of achondroplasia and dwarfism [1] [2] [3].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Vosoritide (BMN 111), a modified recombinant C-type natriuretic peptide (CNP) analogue, engages with natriuretic peptide receptor type B (NPR-B) to diminish the function of fibroblast growth factor receptor 3 (FGFR3). This compound is employed in the study of achondroplasia and dwarfism [1] [2] [3]. |
Molecular Weight | 4102.73 |
Formula | C176H290N56O51S3 |
Cas No. | 1480724-61-5 |
Sequence | Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39) |
Sequence Short | PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.