Your shopping cart is currently empty

Synonyms: BMN-111 acetate, BMN111 acetate, BMN 111 acetate
Vosoritide acetate
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $129 | - | In Stock | |
| 5 mg | $328 | - | In Stock | |
| 10 mg | $529 | - | In Stock | |
| 25 mg | $953 | - | In Stock |
| Description | Vosoritide acetate is a peptide drug designed based on a C-type natriuretic peptide analog. Vosoritide acetate promotes cGMP production by activating the natriuretic peptide receptor-B while antagonizing the inhibitory effects of the FGFR3 signaling pathway on bone growth. Vosoritide acetate is currently used to treat growth disorders such as achondroplasia. |
| Synonyms | BMN-111 acetate, BMN111 acetate, BMN 111 acetate |
| Molecular Weight | 4162.78 |
| Formula | C176H290N56O51S3.C2H4O2 |
| Sequence | Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39) |
| Sequence Short | PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC |
| Storage | Keep away from moisture,Keep away from direct sunlight Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | H2O: 100 mg/mL (24.02 mM) | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | ||||||||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.