Shopping Cart
- Remove All
- Your shopping cart is currently empty
Vm24-toxin, a peptide toxin isolated from the Mexican scorpion Vaejovis mexicanus smithi, serves as an inhibitor of the Kv1.3 potassium channel [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Vm24-toxin, a peptide toxin isolated from the Mexican scorpion Vaejovis mexicanus smithi, serves as an inhibitor of the Kv1.3 potassium channel [1]. |
Alias | Vaejovis mexicanus peptide 24 |
Molecular Weight | 3863.59 |
Formula | C157H253N51O45S9 |
Cas No. | 1373890-79-9 |
Sequence | Ala-Ala-Ala-Ile-Ser-Cys-Val-Gly-Ser-Pro-Glu-Cys-Pro-Pro-Lys-Cys-Arg-Ala-Gln-Gly-Cys-Lys-Asn-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Tyr-Tyr-Cys-NH2 (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36) |
Sequence Short | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC-NH2 (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.