Your shopping cart is currently empty

Vm24-toxin (Vaejovis mexicanus peptide 24) TFA is a peptide composed of 36 amino acids, known for effectively and selectively blocking Kv1.3 channels, exhibiting an affinity (Kd) of approximately 3 pM in lymphocytes. It demonstrates over 1500 times greater affinity for Kv1.3 compared to other tested potassium channels. The structure of Vm24-toxin TFA includes a twisted cystine-stabilized α/β motif, comprising a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Additionally, Vm24-toxin TFA can attenuate the response of CD4+ effector memory T cells to T-cell receptor (TCR) stimulation.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Vm24-toxin (Vaejovis mexicanus peptide 24) TFA is a peptide composed of 36 amino acids, known for effectively and selectively blocking Kv1.3 channels, exhibiting an affinity (Kd) of approximately 3 pM in lymphocytes. It demonstrates over 1500 times greater affinity for Kv1.3 compared to other tested potassium channels. The structure of Vm24-toxin TFA includes a twisted cystine-stabilized α/β motif, comprising a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Additionally, Vm24-toxin TFA can attenuate the response of CD4+ effector memory T cells to T-cell receptor (TCR) stimulation. |
| Targets&IC50 | Kv1.3 channel:3 pM (Kd) |
| Synonyms | Vaejovis mexicanus peptide 24 TFA |
| Sequence | Ala-Ala-Ala-Ile-Ser-Cys-Val-Gly-Ser-Pro-Glu-Cys-Pro-Pro-Lys-Cys-Arg-Ala-Gln-Gly-Cys-Lys-Asn-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Tyr-Tyr-Cys-NH2 (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36) |
| Sequence Short | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.