Shopping Cart
- Remove All
- Your shopping cart is currently empty
Ularitide is a 32-amino acid peptide derived from (95-126 residues) of ANP PROHORMONE (1-126 residues). It isn't biologically inactivated by a peptidase from dog kidney cortex membranes.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | Ularitide is a 32-amino acid peptide derived from (95-126 residues) of ANP PROHORMONE (1-126 residues). It isn't biologically inactivated by a peptidase from dog kidney cortex membranes. |
Synonyms | Human urodilatin, CDD 95-126, ANP 95-126 |
Molecular Weight | 3505.97 |
Formula | C145H234N52O44S3 |
Cas No. | 118812-69-4 |
Relative Density. | 1.56 g/cm3 (Predicted) |
Sequence | Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys11-Cys27) |
Sequence Short | TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge:Cys11-Cys27) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.