Shopping Cart

Remove All
Your shopping cart is currently empty

Brain Natriuretic Peptide-45, rat

😃Good

Catalog No. TP1207Cas No. 123337-89-3

Alias Brain natriuretic peptide-45 rat, BNP-45 (rat)

BNP-45 (rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.

Brain Natriuretic Peptide-45, rat

😃Good

Catalog No. TP1207Alias Brain natriuretic peptide-45 rat, BNP-45 (rat)Cas No. 123337-89-3

BNP-45 (rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.

Pack Size	Price	Availability	Quantity
1 mg	$310	Backorder
5 mg	$814	Backorder

Add to Cart

Add to Quotation

Bulk & Custom

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

Product Introduction

Bioactivity

Description	BNP-45 (rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.
Alias	Brain natriuretic peptide-45 rat, BNP-45 (rat)

Chemical Properties

Molecular Weight	5040.67
Formula	C₂₁₃H₃₄₉N₇₁O₆₅S₃
Cas No.	123337-89-3
Relative Density.	no data available
Sequence	Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys23-Cys39)
Sequence Short	SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys23-Cys39)

Storage & Solubility Information

Storage	keep away from moisture \| Powder: -20°C for 3 years \| In solvent: -80°C for 1 year \| Shipping with blue ice.
Solubility Information	H2O: Soluble

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:

For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments

A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent

DMSO+30% PEG300+5% Tween 80+60% Saline/PBS/ddH₂O. So your working solution concentration is 2 mg/mL。

Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO TargetMol | reagent

(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.

Preparation method for in vivo formula: Take 50 μL DMSO TargetMol | reagent

main solution, add 300 μLPEG300 TargetMol | reagent

mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline/PBS/ddH₂O TargetMol | reagent

mix well and clarify

For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Sci Citations

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

BNP 45Brain Natriuretic Peptide45, ratBNP-45BNP45Brain Natriuretic Peptide-45, ratBrain Natriuretic Peptide 45, rat

Related Tags: buy Brain Natriuretic Peptide-45, rat | purchase Brain Natriuretic Peptide-45, rat | Brain Natriuretic Peptide-45, rat cost | order Brain Natriuretic Peptide-45, rat | Brain Natriuretic Peptide-45, rat chemical structure | Brain Natriuretic Peptide-45, rat formula | Brain Natriuretic Peptide-45, rat molecular weight