Shopping Cart
- Remove All
- Your shopping cart is currently empty
Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is an isoform of the rat brain natriuretic peptide extracted from the rat heart, exhibiting significant hypotensive and natriuretic effects [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is an isoform of the rat brain natriuretic peptide extracted from the rat heart, exhibiting significant hypotensive and natriuretic effects [1]. |
In vivo | Brain Natriuretic Peptide-45, rat (BNP-45, 0.1-2.0 nmol/kg, i.v.), demonstrates significant natriuretic and hypotensive effects in anesthetized spontaneously hypertensive rats (SHR) and Wistar-Kyoto rats (WKY). Higher BNP-45 concentrations are more effective in reducing blood pressure in SHR, while WKY rats display increased sensitivity to its diuretic and natriuretic actions and greater urinary cGMP excretion. Elevated BNP-45 doses result in prolonged blood pressure reduction and urinary cGMP excretion in WKY [1]. |
Synonyms | BNP-45, rat TFA |
Sequence | Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge: Cys23-Cys39) |
Sequence Short | SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfide bridge: Cys23-Cys39) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.