Your shopping cart is currently empty

Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is an isoform of the rat brain natriuretic peptide extracted from the rat heart, exhibiting significant hypotensive and natriuretic effects [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is an isoform of the rat brain natriuretic peptide extracted from the rat heart, exhibiting significant hypotensive and natriuretic effects [1]. |
| In vivo | Brain Natriuretic Peptide-45, rat (BNP-45, 0.1-2.0 nmol/kg, i.v.), demonstrates significant natriuretic and hypotensive effects in anesthetized spontaneously hypertensive rats (SHR) and Wistar-Kyoto rats (WKY). Higher BNP-45 concentrations are more effective in reducing blood pressure in SHR, while WKY rats display increased sensitivity to its diuretic and natriuretic actions and greater urinary cGMP excretion. Elevated BNP-45 doses result in prolonged blood pressure reduction and urinary cGMP excretion in WKY [1]. |
| Synonyms | BNP-45, rat TFA |
| Sequence | Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge: Cys23-Cys39) |
| Sequence Short | SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfide bridge: Cys23-Cys39) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.