Shopping Cart
- Remove All
- Your shopping cart is currently empty
Tityustoxin-Kα (TsTx-Kα) inhibits potassium voltage-gated channels, causing a dose-dependent blockade of the sustained outward current in cultured hippocampal neurons [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Tityustoxin-Kα (TsTx-Kα) inhibits potassium voltage-gated channels, causing a dose-dependent blockade of the sustained outward current in cultured hippocampal neurons [1]. |
Alias | TsTx-Kα |
Cas No. | 152618-71-8 |
Sequence | Val-Phe-Ile-Asn-Ala-Lys-Cys-Arg-Gly-Ser-Pro-Glu-Cys-Leu-Pro-Lys-Cys-Lys-Glu-Ala-Ile-Gly-Lys-Ala-Ala-Gly-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro (Disulfide bridge: Cys7-Cys28, Cys13-Cys33, Cys17-Cys35) |
Sequence Short | VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP (Disulfide bridge: Cys7-Cys28, Cys13-Cys33, Cys17-Cys35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.