Shopping Cart
- Remove All
- Your shopping cart is currently empty
Tat-HA-NR2B9, comprising an HIV-1 Tat transduction domain fragment, an influenza virus hemagglutinin (HA) epitope-tag, and the C-terminal 9 amino acids of NR2B (NR2B9c), has demonstrated efficacy in reducing infarct size and enhancing neurological function following ischemia-induced cerebral injury in rats [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Tat-HA-NR2B9, comprising an HIV-1 Tat transduction domain fragment, an influenza virus hemagglutinin (HA) epitope-tag, and the C-terminal 9 amino acids of NR2B (NR2B9c), has demonstrated efficacy in reducing infarct size and enhancing neurological function following ischemia-induced cerebral injury in rats [1]. |
Sequence | Pro-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Gly-Lys-Leu-Ser-Ser-Ile-Glu-Ser-Asp-Val |
Sequence Short | PGYGRKKRRQRRRGYPYDVPDYAGKLSSIESDV |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.