Shopping Cart
- Remove All
- Your shopping cart is currently empty
TatCN21, with an IC 50 of 77 nM, serves as a potent and selective inhibitor peptide of the calcium/calmodulin-dependent protein kinase II (CaMKII), a ubiquitously-expressed multifunctional serine/threonine protein kinase. It is particularly useful in research pertaining to ischemia and neurodegenerative diseases.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | TatCN21, with an IC 50 of 77 nM, serves as a potent and selective inhibitor peptide of the calcium/calmodulin-dependent protein kinase II (CaMKII), a ubiquitously-expressed multifunctional serine/threonine protein kinase. It is particularly useful in research pertaining to ischemia and neurodegenerative diseases. |
Molecular Weight | 3989.65 |
Formula | C169H303N69O43 |
Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Lys-Arg-Pro-Pro-Lys-Leu-Gly-Gln-Ile-Gly-Arg-Ser-Lys-Arg-Val-Val-Ile-Glu-Asp-Asp-Arg |
Sequence Short | YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.