Your shopping cart is currently empty

TAT-CN21 is a potent and highly selective inhibitory peptide for CaMKII with an IC50 of 77 nM. This product achieves cell permeability through the TAT sequence (YGRKKRRQRRR), effectively blocking the catalytic activity of CaMKII and its interaction with the NMDA receptor subunit GluN2B. It plays a critical role in modulating excitotoxicity, reducing glutamate-induced neuronal damage, and serves as a core pharmacological tool for researching ischemic brain injury, neurodegenerative diseases, and synaptic plasticity.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $99 | - | In Stock |
| Description | TAT-CN21 is a potent and highly selective inhibitory peptide for CaMKII with an IC50 of 77 nM. This product achieves cell permeability through the TAT sequence (YGRKKRRQRRR), effectively blocking the catalytic activity of CaMKII and its interaction with the NMDA receptor subunit GluN2B. It plays a critical role in modulating excitotoxicity, reducing glutamate-induced neuronal damage, and serves as a core pharmacological tool for researching ischemic brain injury, neurodegenerative diseases, and synaptic plasticity. |
| Targets&IC50 | CaMK II:77 nM |
| In vitro | In primary hippocampal neurons, TAT-CN21 (1-20 µM) significantly reduces glutamate-induced excitotoxic death by inhibiting CaMKII substrate phosphorylation and disrupting pathological CaMKII-GluN2B complex formation, with efficacy dependent on administration timing [1]. |
| In vivo | In pharmacological studies using preclinical models of cerebral ischemia, systemic or central administration of TAT-CN21 modulates CaMKII-dependent signaling pathways; the treatment reduces neuronal loss and maintains cognitive or motor functions in stroke models [1]. |
| Molecular Weight | 3989.65 |
| Formula | C169H303N69O43 |
| Smiles | [H]N[C@@H](CC1=CC=C(C=C1)O)C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N2CCC[C@H]2C(N3CCC[C@H]3C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@]([H])(C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@]([H])(C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](CC(O)=O)C(N[C@H](C(O)=O)CCCNC(N)=N)=O)=O)=O)CCC(O)=O)=O)[C@@H](C)CC)=O)C(C)C)=O)C(C)C)=O)CCCNC(N)=N)=O)CCCCN)=O)CO)=O)CCCNC(N)=N)=O)=O)[C@@H](C)CC)=O)CCC(N)=O)=O)=O)CC(C)C)=O)CCCCN)=O)=O)=O)CCCNC(N)=N)=O)CCCCN)=O)CCCNC(N)=N)=O)CCCNC(N)=N)=O)CCCNC(N)=N)=O)CCC(N)=O)=O)CCCNC(N)=N)=O)CCCNC(N)=N)=O)CCCCN)=O)CCCCN)=O)CCCNC(N)=N)=O)=O |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Lys-Arg-Pro-Pro-Lys-Leu-Gly-Gln-Ile-Gly-Arg-Ser-Lys-Arg-Val-Val-Ile-Glu-Asp-Asp-Arg |
| Sequence Short | YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 40 mg/mL (10.03 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.