Shopping Cart
- Remove All
- Your shopping cart is currently empty
TAT-NSF700scr comprises the complete TAT domain and a glycine linker, succeeded by the NSF amino acids arranged randomly. It serves as a control peptide, ineffective in inhibiting SNARE-mediated exocytosis [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | TAT-NSF700scr comprises the complete TAT domain and a glycine linker, succeeded by the NSF amino acids arranged randomly. It serves as a control peptide, ineffective in inhibiting SNARE-mediated exocytosis [1] [2]. |
Molecular Weight | 4109.87 |
Formula | C186H315N61O44 |
Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Ile-Pro-Pro-Val-Tyr-Phe-Ser-Arg-Leu-Asp-Leu-Asn-Leu-Val-Val-Leu-Leu-Leu-Ala-Gln-Leu |
Sequence Short | YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.